PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_02836
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family bZIP
Protein Properties Length: 217aa    MW: 23456.4 Da    PI: 7.8152
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_02836genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.54.5e-11113171563
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 kr++r   NR +A rs +RK  +i eLe+kv++L++e + L  +l+ l+ +++ l +++
  PEQU_02836 113 KRAKRILANRHSAARSKERKVRYISELETKVQALQTEATILSTQLNFLRANSSGLATQN 171
                 9********************************************99998887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-16109173IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.967111174IPR004827Basic-leucine zipper domain
PfamPF001705.9E-10113171IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.4E-11113170No hitNo description
SuperFamilySSF579597.5E-11113165No hitNo description
CDDcd147031.49E-17114163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MESRGSGNSK TGGACSSESE AESCAIDCAL AGESGHSRSI SLDGLVGRVN FCEKSIGVSP  60
SPSSGCKRSM SSECDSMDAT FSLEFGRGEF SGTELKKIMA DKKLEEIALA DPKRAKRILA  120
NRHSAARSKE RKVRYISELE TKVQALQTEA TILSTQLNFL RANSSGLATQ NNELKIRLQA  180
MEQQAHLKDA LNEALSAEVQ RLRLATAELD KSLSQHM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010095678.11e-77putative transcription factor PosF21
RefseqXP_010647567.12e-77PREDICTED: serine/threonine-protein kinase pakB isoform X3
RefseqXP_010647563.12e-77PREDICTED: serine/threonine-protein kinase pakB isoform X3
RefseqXP_010647562.12e-77PREDICTED: serine/threonine-protein kinase pakB isoform X2
SwissprotQ69IL42e-46RF2A_ORYSJ; Transcription factor RF2a
TrEMBLA0A0K9PPW49e-77A0A0K9PPW4_Z
TrEMBLW9QZU92e-77W9QZU9_9R
STRINGVIT_03s0038g00860.t011e-75(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-62bZIP family protein